CTRP3 (C1QTNF3) (NM_030945) Human Mass Spec Standard
CAT#: PH311047
C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_112207)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211047 |
Predicted MW | 27 kDa |
Protein Sequence |
>RC211047 protein sequence
Red=Cloning site Green=Tags(s) MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGN NGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSV ETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVL KLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_112207 |
RefSeq Size | 3624 |
RefSeq ORF | 738 |
Synonyms | C1ATNF3; CORCS; CORS; CORS-26; CORS26; CTRP3 |
Locus ID | 114899 |
UniProt ID | Q9BXJ4 |
Cytogenetics | 5p13.2 |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405756 | C1QTNF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC410641 | C1QTNF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405756 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2 |
USD 396.00 |
|
LY410641 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 1 |
USD 396.00 |
|
PH313742 | C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_852100) |
USD 2,055.00 |
|
TP311047 | Recombinant protein of human C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 1 |
USD 823.00 |
|
TP313742 | Recombinant protein of human C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review