CTRP3 (C1QTNF3) (NM_030945) Human Recombinant Protein
CAT#: TP311047
Recombinant protein of human C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211047 protein sequence
Red=Cloning site Green=Tags(s) MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGN NGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSV ETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVL KLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112207 |
Locus ID | 114899 |
UniProt ID | Q9BXJ4 |
Cytogenetics | 5p13.2 |
Refseq Size | 3624 |
Refseq ORF | 738 |
Synonyms | C1ATNF3; CORCS; CORS; CORS-26; CORS26; CTRP3 |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405756 | C1QTNF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC410641 | C1QTNF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY405756 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2 |
USD 325.00 |
|
LY410641 | Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 1 |
USD 325.00 |
|
PH311047 | C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_112207) |
USD 2,055.00 |
|
PH313742 | C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_852100) |
USD 2,055.00 |
|
TP313742 | Recombinant protein of human C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review