NT5DC1 (NM_152729) Human Mass Spec Standard

CAT#: PH311087

NT5DC1 MS Standard C13 and N15-labeled recombinant protein (NP_689942)

Product Images

Coomassie blue staining of purified NT5DC1 protein (Cat# TP311087). The protein was produced from HEK293T cells transfected with NT5DC1 cDNA clone (Cat# RC211087) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211087
• Predicted MW: 51.8 kDa
• Protein Sequence:
  Sequence Link

  >RC211087 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQHFSLAACDVVGFDLDHTLCRYNLPESAPLIYNSFAQFLVKEKGYDKELLNVTPEDWDFCCKGLALDL
  EDGNFLKLANNGTVLRASHGTKMMTPEVLAEAYGKKEWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCA
  RVVDYLTKLNNGQKTFDFWKDIVAAIQHNYKMSAFKENCGIYFPEIKRDPGRYLHSCPESVKKWLRQLKN
  AGKILLLITSSHSDYCRLLCEYILGNDFTDLFDIVITNALKPGFFSHLPSQRPFRTLENDEEQEALPSLD
  KPGWYSQGNAVHLYELLKKMTGKPEPKVVYFGDSMHSDIFPARHYSNWETVLILEELRGDEGTRSQRPEE
  SEPLEKKGKYEGPKAKPLNTSSKKWGSFFIDSVLGLENTEDSLVYTWSCKRISTYSTIAIPSIEAIAELP
  LDYKFTRFSSSNSKTAGYYPNPPLVLSSDETLISK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689942
• RefSeq Size: 3193
• RefSeq ORF: 1365
• Synonyms: C6orf200; LP2642; NT5C2L1
• Locus ID: 221294
• UniProt ID: Q5TFE4, Q9H2R1
• Cytogenetics: 6q22.1
• Summary: While the exact function of the protein encoded by this gene is not known, it belongs to the 5'(3')-deoxyribonucleotidase family. [provided by RefSeq, May 2010]