SUMF1 (NM_182760) Human Mass Spec Standard

CAT#: PH311092

SUMF1 MS Standard C13 and N15-labeled recombinant protein (NP_877437)

Product Images

Coomassie blue staining of purified SUMF1 protein (Cat# TP311092). The protein was produced from HEK293T cells transfected with SUMF1 cDNA clone (Cat# RC211092) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211092
• Predicted MW: 40.6 kDa
• Protein Sequence:
  Sequence Link

  >RC211092 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRY
  SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFV
  NSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVS
  WNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAP
  VDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARS
  QNTPDSSASNLGFRCAADRLPTMD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_877437
• RefSeq Size: 2179
• RefSeq ORF: 1122
• Synonyms: AAPA3037; FGE; UNQ3037
• Locus ID: 285362
• UniProt ID: Q8NBK3
• Cytogenetics: 3p26.1
• Summary: This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]