Cyclin A2 (CCNA2) (NM_001237) Human Mass Spec Standard

CAT#: PH311148

CCNA2 MS Standard C13 and N15-labeled recombinant protein (NP_001228)

Product Images

Coomassie blue staining of purified CCNA2 protein (Cat# TP311148). The protein was produced from HEK293T cells transfected with CCNA2 cDNA clone (Cat# RC211148) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211148
• Predicted MW: 48.4 kDa
• Protein Sequence:
  Sequence Link

  >RC211148 representing NM_001237
  Red=Cloning site Green=Tags(s)
  
  MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTR
  RVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKP
  LVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSM
  RAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVY
  ITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKY
  LPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
  VSLLNPPETLNL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001228
• RefSeq Size: 1682
• RefSeq ORF: 1296
• Synonyms: CCN1; CCNA
• Locus ID: 890
• UniProt ID: P20248
• Cytogenetics: 4q27
• Summary: 'The protein encoded by this gene belongs to the highly conserved cyclin family, whose members function as regulators of the cell cycle. This protein binds and activates cyclin-dependent kinase 2 and thus promotes transition through G1/S and G2/M. [provided by RefSeq, Aug 2016]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Cell cycle, Progesterone-mediated oocyte maturation