BCL2L2 (NM_004050) Human Mass Spec Standard
CAT#: PH311152
BCL2L2 MS Standard C13 and N15-labeled recombinant protein (NP_004041)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211152 |
| Predicted MW | 20.8 kDa |
| Protein Sequence |
>RC211152 protein sequence
Red=Cloning site Green=Tags(s) MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHS SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004041 |
| RefSeq Size | 3621 |
| RefSeq ORF | 579 |
| Synonyms | BCL-W; BCL2-L-2; BCLW; PPP1R51 |
| Locus ID | 599 |
| UniProt ID | Q92843 |
| Cytogenetics | 14q11.2 |
| Summary | 'This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. [provided by RefSeq, Dec 2010]' |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401312 | BCL2L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401312 | Transient overexpression lysate of BCL2-like 2 (BCL2L2) |
USD 436.00 |
|
| TP311152 | Recombinant protein of human BCL2-like 2 (BCL2L2) |
USD 748.00 |
|
| TP720086 | Recombinant protein of human BCL2-like 2 (BCL2L2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China