TUBA8 (NM_018943) Human Mass Spec Standard

CAT#: PH311175

TUBA8 MS Standard C13 and N15-labeled recombinant protein (NP_061816)

Product Images

Coomassie blue staining of purified TUBA8 protein (Cat# TP311175). The protein was produced from HEK293T cells transfected with TUBA8 cDNA clone (Cat# RC211175) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211175
• Predicted MW: 50.1 kDa
• Protein Sequence:
  Sequence Link

  >RC211175 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGNGKHVPRAVMIDL
  EPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLDRIRKLTDACSGLQGFLIFHS
  FGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY
  DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEK
  AYHEQLSVAEITSSCFEPNSQMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTG
  FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
  AREDLAALEKDYEEVGTDSFEEENEGEEF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061816
• RefSeq Size: 2124
• RefSeq ORF: 1347
• Synonyms: CDCBM8; TUBAL2
• Locus ID: 51807
• UniProt ID: Q9NY65
• Cytogenetics: 22q11.21
• Summary: This gene encodes a member of the alpha tubulin protein family. Alpha tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. Mutations in this gene are associated with polymicrogyria and optic nerve hypoplasia. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2010]
• Protein Families: Druggable Genome
• Protein Pathways: Gap junction, Pathogenic Escherichia coli infection