GPR73B (PROKR2) (NM_144773) Human Mass Spec Standard

CAT#: PH311216

PROKR2 MS Standard C13 and N15-labeled recombinant protein (NP_658986)

Product Images

Coomassie blue staining of purified PROKR2 protein (Cat# TP311216). The protein was produced from HEK293T cells transfected with PROKR2 cDNA clone (Cat# RC211216) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211216
• Predicted MW: 43.8 kDa
• Protein Sequence:
  Sequence Link

  >RC211216 representing NM_144773
  Red=Cloning site Green=Tags(s)
  
  MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIALAGIMLVCGIG
  NFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLY
  VSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMVSILIAIPSAYFATETVLFIVKSQEKIFCGQ
  IWPVDQQLYYKSYFLFIFGVEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCI
  LTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYVVECIAMSNRMINTVCFVTVKNNTMKYFKKMMLL
  HWRPSQRGSKSSADLDLRTNGVPTTEEVDCIRLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_658986
• RefSeq Size: 1155
• RefSeq ORF: 1152
• Synonyms: dJ680N4.3; GPR73b; GPR73L1; GPRg2; HH3; KAL3; PKR2
• Locus ID: 128674
• UniProt ID: Q8NFJ6, A8K1T0
• Cytogenetics: 20p12.3
• Summary: Prokineticins are secreted proteins that can promote angiogenesis and induce strong gastrointestinal smooth muscle contraction. The protein encoded by this gene is an integral membrane protein and G protein-coupled receptor for prokineticins. The encoded protein is similar in sequence to GPR73, another G protein-coupled receptor for prokineticins. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, GPCR, Transmembrane