MED9 (NM_018019) Human Mass Spec Standard

CAT#: PH311226

MED9 MS Standard C13 and N15-labeled recombinant protein (NP_060489)

Product Images

Coomassie blue staining of purified MED9 protein (Cat# TP311226). The protein was produced from HEK293T cells transfected with MED9 cDNA clone (Cat# RC211226) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211226
• Predicted MW: 16.4 kDa
• Protein Sequence:
  Sequence Link

  >RC211226 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPRPQSPARAREEENYSFLPLVH
  NIIKCMDKDSPEVHQDLNALKSKFQEMRKLISTMPGIHLSPEQQQQQLQSLREQVRTKNELLQKYKSLCM
  FEIPKE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060489
• RefSeq Size: 2222
• RefSeq ORF: 438
• Synonyms: MED25
• Locus ID: 55090
• UniProt ID: Q9NWA0
• Cytogenetics: 17p11.2
• Summary: The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]