DECR1 (NM_001359) Human Mass Spec Standard

CAT#: PH311257

DECR1 MS Standard C13 and N15-labeled recombinant protein (NP_001350)

Product Images

Coomassie blue staining of purified DECR1 protein (Cat# TP311257). The protein was produced from HEK293T cells transfected with DECR1 cDNA clone (Cat# RC211257) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211257
• Predicted MW: 36.1 kDa
• Protein Sequence:
  Sequence Link

  >RC211257 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLPARVFFTLGSRLPCGLAPRRFFSYGTKILYQNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTG
  LGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNI
  VINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPS
  ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANL
  AAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001350
• RefSeq Size: 1251
• RefSeq ORF: 1005
• Synonyms: DECR; NADPH; SDR18C1
• Locus ID: 1666
• UniProt ID: Q16698, A0A024R9D7
• Cytogenetics: 8q21.3
• Summary: This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome