SLURP1 (NM_020427) Human Mass Spec Standard

CAT#: PH311275

SLURP1 MS Standard C13 and N15-labeled recombinant protein (NP_065160)

Product Images

Coomassie blue staining of purified SLURP1 protein (Cat# TP311275). The protein was produced from HEK293T cells transfected with SLURP1 cDNA clone (Cat# RC211275) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211275
• Predicted MW: 11.2 kDa
• Protein Sequence:
  Sequence Link

  >RC211275 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT
  RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065160
• RefSeq Size: 537
• RefSeq ORF: 309
• Synonyms: ANUP; ARS; ArsB; LY6-MT; LY6LS; MDM
• Locus ID: 57152
• UniProt ID: P55000
• Cytogenetics: 8q24.3
• Summary: The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein