PF4 (NM_002619) Human Mass Spec Standard

CAT#: PH311322

PF4 MS Standard C13 and N15-labeled recombinant protein (NP_002610)

Product Images

Coomassie blue staining of purified PF4 protein (Cat# TP311322). The protein was produced from HEK293T cells transfected with PF4 cDNA clone (Cat# RC211322) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211322
• Predicted MW: 10.8 kDa
• Protein Sequence:
  Sequence Link

  >RC211322 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTA
  QLIATLKNGRKICLDLQAPLYKKIIKKLLES
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002610
• RefSeq Size: 878
• RefSeq ORF: 303
• Synonyms: CXCL4; PF-4; SCYB4
• Locus ID: 5196
• UniProt ID: P02776
• Cytogenetics: 4q13.3
• Summary: 'This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is chemotactic for numerous other cell type and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. The protein also exhibits antimicrobial activity against Plasmodium falciparum. [provided by RefSeq, Oct 2014]'
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction