OPA1 (NM_130832) Human Mass Spec Standard
CAT#: PH311417
OPA1 MS Standard C13 and N15-labeled recombinant protein (NP_570845)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211417 |
Predicted MW | 109.4 kDa |
Protein Sequence |
>RC211417 representing NM_130832
Red=Cloning site Green=Tags(s) MWRLRRAAVACEVCQSLVKHSSGIKGSLPLQKLHLVSRSIYHSHHPTLKLQRPQLRTSFQQFSSLTNLPL RKLKFSPIKYGYQPRRNFWPARLATRLLKLRYLILGSAVGGGYTAKKTFDQWKDMIPDLSEYKWIVPDIV WEIDEYIDFGHKLVSEVIGASDLLLLLGSPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLK YQRILERLEKENKELRKLVLQKDDKGIHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQS AGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMR KNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIILCIQD GSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMKALGYFAVVTGKGNS SESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWKMVRESVEQQADSFKATRFNLETEW KNNYPRLRELDRNELFEKAKNEILDEVISLSQVTPKHWEEILQQSLWERVSTHVIENIYLPAAQTMNSGT FNTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFA EDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVH NETKNELEKMLKCNEEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQVYRRHFLKTALNHCNLCRR GFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLL TGKRVQLAEDLKKVREIQEKLDAFIEALHQEK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_570845 |
RefSeq Size | 6291 |
RefSeq ORF | 2826 |
Synonyms | BERHS; largeG; MGM1; MTDPS14; NPG; NTG |
Locus ID | 4976 |
UniProt ID | E5KLK0 |
Cytogenetics | 3q29 |
Summary | 'The protein encoded by this gene is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. The encoded protein localizes to the inner mitochondrial membrane and helps regulate mitochondrial stability and energy output. This protein also sequesters cytochrome c. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. [provided by RefSeq, Aug 2017]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408906 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC408908 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC408909 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC408910 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC408911 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC414474 | OPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408906 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 605.00 |
|
LY408908 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 605.00 |
|
LY408909 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 5 |
USD 605.00 |
|
LY408910 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 6 |
USD 605.00 |
|
LY408911 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 7 |
USD 605.00 |
|
LY414474 | Transient overexpression lysate of optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 396.00 |
|
TP311417 | Recombinant protein of human optic atrophy 1 (autosomal dominant) (OPA1), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review