ethanolamine kinase (ETNK1) (NM_001039481) Human Mass Spec Standard

CAT#: PH311556

ETNK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034570)

Product Images

Coomassie blue staining of purified ETNK1 protein (Cat# TP311556). The protein was produced from HEK293T cells transfected with ETNK1 cDNA clone (Cat# RC211556) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211556
• Predicted MW: 27.8 kDa
• Protein Sequence:
  Sequence Link

  >RC211556 representing NM_001039481
  Red=Cloning site Green=Tags(s)
  
  MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPA
  VLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTL
  QLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEF
  IQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF
  
  TRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001034570
• RefSeq Size: 910
• RefSeq ORF: 774
• Synonyms: EKI; EKI 1; EKI1; Nbla10396
• Locus ID: 55500
• UniProt ID: Q9HBU6, Q86U68
• Cytogenetics: 12p12.1
• Summary: This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways