ethanolamine kinase (ETNK1) (NM_001039481) Human Mass Spec Standard
CAT#: PH311556
ETNK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034570)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211556 |
Predicted MW | 27.8 kDa |
Protein Sequence |
>RC211556 representing NM_001039481
Red=Cloning site Green=Tags(s) MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPA VLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTL QLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEF IQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001034570 |
RefSeq Size | 910 |
RefSeq ORF | 774 |
Synonyms | EKI; EKI 1; EKI1; Nbla10396 |
Locus ID | 55500 |
UniProt ID | Q9HBU6, Q86U68 |
Cytogenetics | 12p12.1 |
Summary | This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422057 | ETNK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY422057 | Transient overexpression lysate of ethanolamine kinase 1 (ETNK1), transcript variant 2 |
USD 396.00 |
|
TP311556 | Recombinant protein of human ethanolamine kinase 1 (ETNK1), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review