ethanolamine kinase (ETNK1) (NM_001039481) Human Recombinant Protein

CAT#: TP311556

Recombinant protein of human ethanolamine kinase 1 (ETNK1), transcript variant 2

Product Images

Coomassie blue staining of purified ETNK1 protein (Cat# TP311556). The protein was produced from HEK293T cells transfected with ETNK1 cDNA clone (Cat# RC211556) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC211556 representing NM_001039481
  Red=Cloning site Green=Tags(s)
  
  MLCGRPRSSSDNRNFLRERAGLSSAAVQTRIGNSAASRRSPAARPPVPAPPALPRGRPGTEGSTSLSAPA
  VLVVAVAVVVVVVSAVAWAMANYIHVPPGSPEVPKLNVTVQDQEEHRCREGALSLLQHLRPHWDPQEVTL
  QLFTDGITNKLIGCYVGNTMEDVVLVRIYGNKTELLVDRDEEVKSFRVLQAHGCAPQLYCTFNNGLCYEF
  IQGEALDPKHVCNPAIFSLSSLTLCKGKTTRCFGLTGCRGSRLLLSFF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034570
• Locus ID: 55500
• UniProt ID: Q9HBU6, Q86U68
• Cytogenetics: 12p12.1
• Refseq Size: 910
• Refseq ORF: 774
• Synonyms: EKI; EKI 1; EKI1; Nbla10396
• Summary: This gene encodes an ethanolamine kinase, which functions in the first committed step of the phosphatidylethanolamine synthesis pathway. This cytosolic enzyme is specific for ethanolamine and exhibits negligible kinase activity on choline. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Glycerophospholipid metabolism, Metabolic pathways