CLEC10A (NM_006344) Human Mass Spec Standard

CAT#: PH311598

CLEC10A MS Standard C13 and N15-labeled recombinant protein (NP_006335)

Product Images

Coomassie blue staining of purified CLEC10A protein (Cat# TP311598). The protein was produced from HEK293T cells transfected with CLEC10A cDNA clone (Cat# RC211598) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211598
• Predicted MW: 32.7 kDa
• Protein Sequence:
  Sequence Link

  >RC211598 representing NM_006344
  Red=Cloning site Green=Tags(s)
  
  MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLV
  TLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQV
  ATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGS
  AYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVC
  EAGLGQTSQESH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006335
• RefSeq Size: 1716
• RefSeq ORF: 876
• Synonyms: CD301; CLECSF13; CLECSF14; HML; HML2; MGL
• Locus ID: 10462
• UniProt ID: Q8IUN9
• Cytogenetics: 17p13.1
• Summary: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane