Kv beta 2 (KCNAB2) (NM_003636) Human Mass Spec Standard
CAT#: PH311690
KCNAB2 MS Standard C13 and N15-labeled recombinant protein (NP_003627)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211690 |
| Predicted MW | 41 kDa |
| Protein Sequence |
>RC211690 protein sequence
Red=Cloning site Green=Tags(s) MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAE QLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGL KASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLTPP ICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSE EGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNADQLMENIGAIQVLPKLSSSIIHE IDSILGNKPYSKKDYRS myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_003627 |
| RefSeq Size | 4224 |
| RefSeq ORF | 1101 |
| Synonyms | AKR6A5; HKvbeta2; HKvbeta2.1; HKvbeta2.2; KCNA2B; KV-BETA-2 |
| Locus ID | 8514 |
| UniProt ID | Q13303, A1PR14 |
| Cytogenetics | 1p36.31 |
| Summary | Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Dec 2010] |
| Protein Families | Druggable Genome, Ion Channels: Other |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406850 | KCNAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC418536 | KCNAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY406850 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 2 |
USD 436.00 |
|
| LY418536 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1 |
USD 436.00 |
|
| PH314602 | KCNAB2 MS Standard C13 and N15-labeled recombinant protein (NP_742128) |
USD 2,055.00 |
|
| TP311690 | Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 1 |
USD 823.00 |
|
| TP314602 | Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, beta member 2 (KCNAB2), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China