SIN1 (MAPKAP1) (NM_001006617) Human Mass Spec Standard

CAT#: PH311745

MAPKAP1 MS Standard C13 and N15-labeled recombinant protein (NP_001006618)

Product Images

Coomassie blue staining of purified MAPKAP1 protein (Cat# TP311745). The protein was produced from HEK293T cells transfected with MAPKAP1 cDNA clone (Cat# RC211745) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211745
• Predicted MW: 58.9 kDa
• Protein Sequence:
  Sequence Link

  >RC211745 representing NM_001006617
  Red=Cloning site Green=Tags(s)
  
  MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSV
  DITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQS
  ILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLI
  CWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLF
  VRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFC
  LVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS
  TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA
  STARADYFAQKQRKLNRRTSFSFQKEKKSGQQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001006618
• RefSeq Size: 3395
• RefSeq ORF: 1566
• Synonyms: JC310; MIP1; SIN1; SIN1b; SIN1g
• Locus ID: 79109
• UniProt ID: Q9BPZ7
• Cytogenetics: 9q33.3
• Summary: This gene encodes a protein that is highly similar to the yeast SIN1 protein, a stress-activated protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been described. Alternate polyadenylation sites as well as alternate 3' UTRs have been identified for transcripts of this gene. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome