VENTX (NM_014468) Human Mass Spec Standard

CAT#: PH311761

VENTX MS Standard C13 and N15-labeled recombinant protein (NP_055283)

Product Images

Coomassie blue staining of purified VENTX protein (Cat# TP311761). The protein was produced from HEK293T cells transfected with VENTX cDNA clone (Cat# RC211761) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211761
• Predicted MW: 27.5 kDa
• Protein Sequence:
  Sequence Link

  >RC211761 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSPGSLPGPGQTSGAREPPQAVSIKEAAGSS
  NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQ
  NRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQ
  EALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055283
• RefSeq Size: 2422
• RefSeq ORF: 774
• Synonyms: HPX42B; NA88A; VENTX2
• Locus ID: 27287
• UniProt ID: O95231
• Cytogenetics: 10q26.3
• Summary: This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors