VENTX (NM_014468) Human Mass Spec Standard
CAT#: PH311761
VENTX MS Standard C13 and N15-labeled recombinant protein (NP_055283)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211761 |
Predicted MW | 27.5 kDa |
Protein Sequence |
>RC211761 protein sequence
Red=Cloning site Green=Tags(s) MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSPGSLPGPGQTSGAREPPQAVSIKEAAGSS NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQ NRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQ EALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055283 |
RefSeq Size | 2422 |
RefSeq ORF | 774 |
Synonyms | HPX42B; NA88A; VENTX2 |
Locus ID | 27287 |
UniProt ID | O95231 |
Cytogenetics | 10q26.3 |
Summary | This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415250 | VENTX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415250 | Transient overexpression lysate of VENT homeobox homolog (Xenopus laevis) (VENTX) |
USD 396.00 |
|
TP311761 | Recombinant protein of human VENT homeobox homolog (Xenopus laevis) (VENTX) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review