PPP1R14D (NM_017726) Human Mass Spec Standard

CAT#: PH311763

PPP1R14D MS Standard C13 and N15-labeled recombinant protein (NP_060196)

Product Images

Coomassie blue staining of purified PPP1R14D protein (Cat# TP311763). The protein was produced from HEK293T cells transfected with PPP1R14D cDNA clone (Cat# RC211763) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211763
• Predicted MW: 16.5 kDa
• Protein Sequence:
  Sequence Link

  >RC211763 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWL
  EMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRL
  SRPQK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060196
• RefSeq Size: 764
• RefSeq ORF: 435
• Synonyms: CPI17-like; GBPI-1; GBPI1
• Locus ID: 54866
• UniProt ID: Q9NXH3
• Cytogenetics: 15q15.1
• Summary: Protein phosphatase-1 (PP1; see MIM 176875) is a major cellular phosphatase that reverses serine/threonine protein phosphorylation. PPP1R14D is a PP1 inhibitor that itself is regulated by phosphorylation (Liu et al., 2004 [PubMed 12974676]). [supplied by OMIM, Feb 2010]
• Protein Families: Druggable Genome