SIRPB1 (NM_006065) Human Mass Spec Standard

CAT#: PH311765

SIRPB1 MS Standard C13 and N15-labeled recombinant protein (NP_006056)

Product Images

Coomassie blue staining of purified SIRPB1 protein (Cat# TP311765). The protein was produced from HEK293T cells transfected with SIRPB1 cDNA clone (Cat# RC211765) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211765
• Predicted MW: 43.2 kDa
• Protein Sequence:
  Sequence Link

  >RC211765 representing NM_006065
  Red=Cloning site Green=Tags(s)
  
  MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLCCAMTSLIPVGPIMWFRG
  AGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTE
  LSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHS
  TARVVLTRGDVHSQVICEMAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPR
  GLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISA
  HQKEHGSDITHEPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006056
• RefSeq Size: 3804
• RefSeq ORF: 1194
• Synonyms: CD172b; SIRP-BETA-1
• Locus ID: 10326
• UniProt ID: O00241
• Cytogenetics: 20p13
• Summary: The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]
• Protein Families: Druggable Genome, Transmembrane