RABL2A (NM_007082) Human Mass Spec Standard

CAT#: PH311854

RABL2A MS Standard C13 and N15-labeled recombinant protein (NP_009013)

Product Images

Coomassie blue staining of purified RABL2A protein (Cat# TP311854). The protein was produced from HEK293T cells transfected with RABL2A cDNA clone (Cat# RC211854) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211854
• Predicted MW: 26.2 kDa
• Protein Sequence:
  Sequence Link

  >RC211854 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTI
  LVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADIN
  VTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPD
  QEQSSSIETPSEEAASPHS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009013
• RefSeq Size: 1143
• RefSeq ORF: 687
• Synonyms: FLJ78724; MGC117180
• Locus ID: 11159
• UniProt ID: Q9UBK7
• Cytogenetics: 2q14.1
• Summary: This gene is a member of the RAB gene family which belongs to the RAS GTPase superfamily. The proteins in the family of RAS-related signaling molecules are small GTP-binding proteins that play important roles in the regulation of exocytotic and endocytotic pathways. This gene maps to the site of an ancestral telomere fusion event and may be a subtelomeric gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]
• Protein Families: Druggable Genome