PDE4 (PDE4B) (NM_002600) Human Mass Spec Standard
CAT#: PH311956
PDE4B MS Standard C13 and N15-labeled recombinant protein (NP_002591)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211956 |
Predicted MW | 83.2 kDa |
Protein Sequence |
>RC211956 representing NM_002600
Red=Cloning site Green=Tags(s) MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQSERARTPEGDG ISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVLHATFPGHSQRRESFLYRSDS DYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVRNNFTILTNLHGTSNKRSPAASQPPVSRVNP QEESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFL DKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGL NIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEE HCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMV HCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETW ADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHS YFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002591 |
RefSeq Size | 4264 |
RefSeq ORF | 2208 |
Synonyms | DPDE4; PDEIVB |
Locus ID | 5142 |
UniProt ID | Q07343, X5DNX5 |
Cytogenetics | 1p31.3 |
Summary | 'This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. The encoded protein regulates the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]' |
Protein Families | Druggable Genome |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400417 | PDE4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC400919 | PDE4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC421908 | PDE4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400417 | Transient overexpression lysate of phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant b |
USD 605.00 |
|
LY400919 | Transient overexpression lysate of phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant a |
USD 605.00 |
|
LY421908 | Transient overexpression lysate of phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant d |
USD 396.00 |
|
PH310912 | PDE4B MS Standard C13 and N15-labeled recombinant protein (NP_001032418) |
USD 2,055.00 |
|
TP310912 | Recombinant protein of human phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant d |
USD 867.00 |
|
TP311956 | Recombinant protein of human phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila) (PDE4B), transcript variant a |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review