CAPSL (NM_144647) Human Mass Spec Standard
CAT#: PH311974
CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_653248)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC211974 |
Predicted MW | 23.1 kDa |
Protein Sequence |
>RC211974 protein sequence
Red=Cloning site Green=Tags(s) MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEV EELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQN GEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_653248 |
RefSeq Size | 1019 |
RefSeq ORF | 594 |
Synonyms | MGC26610 |
Locus ID | 133690 |
UniProt ID | Q8WWF8 |
Cytogenetics | 5p13.2 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408188 | CAPSL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC421009 | CAPSL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425789 | CAPSL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY408188 | Transient overexpression lysate of calcyphosine-like (CAPSL), transcript variant 1 |
USD 325.00 |
|
LY421009 | Transient overexpression lysate of calcyphosine-like (CAPSL), transcript variant 2 |
USD 325.00 |
|
LY425789 | Transient overexpression lysate of calcyphosine-like (CAPSL), transcript variant 2 |
USD 325.00 |
|
PH305410 | CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_001036090) |
USD 2,055.00 |
|
TP305410 | Recombinant protein of human calcyphosine-like (CAPSL), transcript variant 2 |
USD 823.00 |
|
TP311974 | Recombinant protein of human calcyphosine-like (CAPSL), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review