Oct4 (POU5F1) (NM_002701) Human Mass Spec Standard
CAT#: PH311998
POU5F1 MS Standard C13 and N15-labeled recombinant protein (NP_002692)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211998 |
| Predicted MW | 38.4 kDa |
| Protein Sequence |
>RC211998 representing NM_002701
Red=Cloning site Green=Tags(s) MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFC GGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIK ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEE ADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCN RRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSN myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002692 |
| RefSeq Size | 1417 |
| RefSeq ORF | 1080 |
| Synonyms | Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4 |
| Locus ID | 5460 |
| UniProt ID | Q01860, D2IYK3 |
| Cytogenetics | 6p21.33 |
| Summary | 'This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq, Oct 2013]' |
| Protein Families | Adult stem cells, Cancer stem cells, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Transcription Factors |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400950 | POU5F1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC404373 | POU5F1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400950 | Transient overexpression lysate of POU class 5 homeobox 1 (POU5F1), transcript variant 1 |
USD 436.00 |
|
| LY404373 | Transient overexpression lysate of POU class 5 homeobox 1 (POU5F1), transcript variant 2 |
USD 436.00 |
|
| TP311998 | Recombinant protein of human POU class 5 homeobox 1 (POU5F1), transcript variant 1 |
USD 748.00 |
|
| TP760938 | Purified recombinant protein of Human POU class 5 homeobox 1 (POU5F1/OCT4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China