WBP5 (TCEAL9) (NM_016303) Human Mass Spec Standard
CAT#: PH312064
WBP5 MS Standard C13 and N15-labeled recombinant protein (NP_057387)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212064 |
Predicted MW | 12.7 kDa |
Protein Sequence |
>RC212064 protein sequence
Red=Cloning site Green=Tags(s) MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDM FREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057387 |
RefSeq Size | 1102 |
RefSeq ORF | 312 |
Synonyms | WBP5; WEX6 |
Locus ID | 51186 |
UniProt ID | Q9UHQ7 |
Cytogenetics | Xq22.2 |
Summary | The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414074 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423688 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423689 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423690 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425164 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425165 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425166 | WBP5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414074 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 1 |
USD 396.00 |
|
LY423688 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 2 |
USD 396.00 |
|
LY423689 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 3 |
USD 396.00 |
|
LY423690 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 4 |
USD 396.00 |
|
LY425164 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 2 |
USD 396.00 |
|
LY425165 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 3 |
USD 396.00 |
|
LY425166 | Transient overexpression lysate of WW domain binding protein 5 (WBP5), transcript variant 4 |
USD 396.00 |
|
TP312064 | Recombinant protein of human WW domain binding protein 5 (WBP5), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review