MS4A7 (NM_206939) Human Mass Spec Standard

CAT#: PH312066

MS4A7 MS Standard C13 and N15-labeled recombinant protein (NP_996822)

Product Images

Coomassie blue staining of purified MS4A7 protein (Cat# TP312066). The protein was produced from HEK293T cells transfected with MS4A7 cDNA clone (Cat# RC212066) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212066
• Predicted MW: 26.1 kDa
• Protein Sequence:
  Sequence Link

  >RC212066 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAP
  YPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMV
  ALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQL
  YSNNPGSSFSSTQSQDHIQQVKKSSSRSWI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_996822
• RefSeq Size: 2976
• RefSeq ORF: 720
• Synonyms: 4SPAN2; CD20L4; CFFM4; MS4A8
• Locus ID: 58475
• UniProt ID: Q9GZW8, A0A024R556
• Cytogenetics: 11q12.2
• Summary: This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane