RRAGD (NM_021244) Human Mass Spec Standard

CAT#: PH312160

RRAGD MS Standard C13 and N15-labeled recombinant protein (NP_067067)

Product Images

Coomassie blue staining of purified RRAGD protein (Cat# TP312160). The protein was produced from HEK293T cells transfected with RRAGD cDNA clone (Cat# RC212160) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212160
• Predicted MW: 45.4 kDa
• Protein Sequence:
  Sequence Link

  >RC212160 representing NM_021244
  Red=Cloning site Green=Tags(s)
  
  MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTEVKPRILLMGL
  RRSGKSSIQKVVFHKMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGA
  LIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLE
  KIHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDM
  QTYELCCDMIDVVIDISCIYGLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERK
  GLIDYNFHCFRKAIHEVFEVRMKVVKSRKVQNRLQKKKRATPNGTPRVLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067067
• RefSeq Size: 1453
• RefSeq ORF: 1200
• Synonyms: bA11D8.2.1; RAGD
• Locus ID: 58528
• UniProt ID: Q9NQL2
• Cytogenetics: 6q15
• Summary: RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways. [supplied by OMIM, Apr 2004]