NPTX1 (NM_002522) Human Mass Spec Standard

CAT#: PH312316

NPTX1 MS Standard C13 and N15-labeled recombinant protein (NP_002513)

Product Images

Coomassie blue staining of purified NPTX1 protein (Cat# TP312316). The protein was produced from HEK293T cells transfected with NPTX1 cDNA clone (Cat# RC212316) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212316
• Predicted MW: 47.12 kDa
• Protein Sequence:
  Sequence Link

  >RC212316 representing NM_002522
  Red=Cloning site Green=Tags(s)
  
  MPAGRAARTCALLALCLLGAGAQDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQLRETVLQQKE
  TILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSL
  KTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQ
  RISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQAN
  ELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQ
  GVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGA
  TKWTFEACRQIN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002513
• RefSeq Size: 5441
• RefSeq ORF: 1296
• Synonyms: NP1
• Locus ID: 4884
• UniProt ID: Q15818
• Cytogenetics: 17q25.3
• Summary: 'NPTX1 is a member of the neuronal pentraxin gene family. Neuronal pentraxin 1 is similar to the rat NP1 gene which encodes a binding protein for the snake venom toxin taipoxin. Human NPTX1 mRNA is exclusively localized to the nervous system. [provided by RefSeq, Jul 2008]'
• Protein Families: Secreted Protein