PKIB (NM_181795) Human Mass Spec Standard

CAT#: PH312372

PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861460)

Product Images

Coomassie blue staining of purified PKIB protein (Cat# TP312372). The protein was produced from HEK293T cells transfected with PKIB cDNA clone (Cat# RC212372) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212372
• Predicted MW: 8.3 kDa
• Protein Sequence:
  Sequence Link

  >RC212372 representing NM_181795
  Red=Cloning site Green=Tags(s)
  
  MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQL
  EKPQNEEK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_861460
• RefSeq Size: 1909
• RefSeq ORF: 234
• Synonyms: PRKACN2
• Locus ID: 5570
• UniProt ID: Q9C010
• Cytogenetics: 6q22.31
• Summary: 'This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role in prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]'
• Protein Families: Druggable Genome