FIGLA (NM_001004311) Human Mass Spec Standard

CAT#: PH312562

FIGLA MS Standard C13 and N15-labeled recombinant protein (NP_001004311)

Product Images

Coomassie blue staining of purified FIGLA protein (Cat# TP312562). The protein was produced from HEK293T cells transfected with FIGLA cDNA clone (Cat# RC212562) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212562
• Predicted MW: 23.9 kDa
• Protein Sequence:
  Sequence Link

  >RC212562 representing NM_001004311
  Red=Cloning site Green=Tags(s)
  
  MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENLQLVLERRRVA
  NAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDLLEGAKDSKKQDPDEQSYSNN
  SSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSGEPAHACRHSVMSTTEIISPTRSLDRFPEVE
  LLSHRLPQV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001004311
• RefSeq Size: 724
• RefSeq ORF: 657
• Synonyms: BHLHC8; FIGALPHA; POF6
• Locus ID: 344018
• UniProt ID: Q6QHK4
• Cytogenetics: 2p13.3
• Summary: This gene encodes a protein that functions in postnatal oocyte-specific gene expression. The protein is a basic helix-loop-helix transcription factor that regulates multiple oocyte-specific genes, including genes involved in folliculogenesis and those that encode the zona pellucida. Mutations in this gene cause premature ovarian failure type 6. [provided by RefSeq, Sep 2009]