FGFR1 (NM_023107) Human Mass Spec Standard
CAT#: PH312579
FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075595)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC212579 |
| Predicted MW | 30.9 kDa |
| Protein Sequence |
>RC212579 representing NM_023107
Red=Cloning site Green=Tags(s) MWSWKCLLFWAVLVTATLCTARPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPE KMEKKLHAVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYT CIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSK IGPDNLPYVQILKVIMAPVFVGQSTGKETTVSGAQVPVGRLSCPRMGSFLTLQAHTLHLSRDLATSPRTS NRGHKVEVSWEQRAAGMGGAGL myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_075595 |
| RefSeq Size | 2590 |
| RefSeq ORF | 906 |
| Synonyms | BFGFR; CD331; CEK; FGFBR; FLG; FLJ99988; FLT2; HBGFR; KAL2; N-SAM; OGD |
| Locus ID | 2260 |
| Cytogenetics | 8p11.23 |
| Summary | 'The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds both acidic and basic fibroblast growth factors and is involved in limb induction. Mutations in this gene have been associated with Pfeiffer syndrome, Jackson-Weiss syndrome, Antley-Bixler syndrome, osteoglophonic dysplasia, and autosomal dominant Kallmann syndrome 2. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
| Protein Pathways | Adherens junction, MAPK signaling pathway, Melanoma, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402963 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC411517 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC411518 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC411519 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC414376 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429471 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429717 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC429718 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429719 | FGFR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402963 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 1 |
USD 436.00 |
|
| LY411517 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 4 |
USD 665.00 |
|
| LY411518 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 5 |
USD 436.00 |
|
| LY411519 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 6 |
USD 436.00 |
|
| LY414376 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 2 |
USD 665.00 |
|
| LY429471 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 2 |
USD 605.00 |
|
| LY429717 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 4 |
USD 605.00 |
|
| LY429718 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 5 |
USD 396.00 |
|
| LY429719 | Transient overexpression lysate of fibroblast growth factor receptor 1 (FGFR1), transcript variant 6 |
USD 396.00 |
|
| PH302080 | FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075598) |
USD 2,055.00 |
|
| PH314979 | FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075596) |
USD 2,055.00 |
|
| PH320009 | FGFR1 MS Standard C13 and N15-labeled recombinant protein (NP_075594) |
USD 2,055.00 |
|
| TP302080 | Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1), transcript variant 1 |
USD 867.00 |
|
| TP312579 | Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1), transcript variant 5 |
USD 823.00 |
|
| TP314979 | Purified recombinant protein of Homo sapiens fibroblast growth factor receptor 1 (FGFR1), transcript variant 6 |
USD 748.00 |
|
| TP320009 | Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1), transcript variant 4 |
USD 748.00 |
|
| TP700118 | Purified recombinant protein of Human fibroblast growth factor receptor 1, transcript variant 1, with C-terminal DDK/His tag, expressed in human cells |
USD 748.00 |
|
| TP700119 | Purified recombinant protein of human fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, Pfeiffer syndrome) (FGFR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
|
| TP700120 | Purified recombinant protein of human fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, Pfeiffer syndrome) (FGFR1), transcript variant 3, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
|
| TP710005 | Recombinant protein of human fibroblast growth factor receptor 1 (FGFR1),residues 1-376 polyhistidine tag, expressed in sf9 cell |
USD 425.00 |
|
| TP710236 | Purified recombinant protein of Human fibroblast growth factor receptor 1 (FGFR1), transcript variant 1, residues 1-376aa, secretory expressed, with C-terminal HIS tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China