TMEM231 (NM_001077418) Human Mass Spec Standard

CAT#: PH312590

TMEM231 MS Standard C13 and N15-labeled recombinant protein (NP_001070886)

Product Images

Coomassie blue staining of purified TMEM231 protein (Cat# TP312590). The protein was produced from HEK293T cells transfected with TMEM231 cDNA clone (Cat# RC212590) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212590
• Predicted MW: 35.9 kDa
• Protein Sequence:
  Sequence Link

  >RC212590 representing NM_001077418
  Red=Cloning site Green=Tags(s)
  
  MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLV
  ALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILT
  FSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDL
  THIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIF
  LWVFERIKIFVFQNQVVTTIPVTVTPRGDLCKEHLS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001070886
• RefSeq Size: 2911
• RefSeq ORF: 948
• Synonyms: ALYE870; JBTS20; MKS11; PRO1886
• Locus ID: 79583
• UniProt ID: Q9H6L2
• Cytogenetics: 16q23.1
• Summary: This gene encodes a transmembrane protein, which is a component of the B9 complex involved in the formation of the diffusion barrier between the cilia and plasma membrane. Mutations in this gene cause Joubert syndrome (JBTS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2013]
• Protein Families: Transmembrane