MNX1 (NM_005515) Human Mass Spec Standard

CAT#: PH312606

MNX1 MS Standard C13 and N15-labeled recombinant protein (NP_005506)

Product Images

Coomassie blue staining of purified MNX1 protein (Cat# TP312606). The protein was produced from HEK293T cells transfected with MNX1 cDNA clone (Cat# RC212606) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212606
• Predicted MW: 40.57 kDa
• Protein Sequence:
  Sequence Link

  >RC212606 representing NM_005515
  Red=Cloning site Green=Tags(s)
  
  MEKSKNFRIDALLAVDPPRAASAQSAPLALVTSLAAAASGTGGGGGGGGASGGTSGSCSPASSEPPAAPA
  DRLRAESPSPPRLLAAHCALLPKPGFLGAGGGGGGTGGGHGGPHHHAHPGAAAAAAAAAAAAAAGGLALG
  LHPGGAQGGAGLPAQAALYGHPVYGYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQL
  DQWLRASTAGMILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLML
  TETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPAPGDKGSGRRLRD
  LRDSDPEEDEDEDDEDHFPYSNGASVHAASSDCSSEDDSPPPRPSHQPAPQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005506
• RefSeq Size: 2176
• RefSeq ORF: 1203
• Synonyms: HB9; HLXB9; HOXHB9; SCRA1
• Locus ID: 3110
• UniProt ID: P50219
• Cytogenetics: 7q36.3
• Summary: This gene encodes a nuclear protein, which contains a homeobox domain and is a transcription factor. Mutations in this gene result in Currarino syndrome, an autosomic dominant congenital malformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS
• Protein Pathways: Maturity onset diabetes of the young