TGF beta 2 (TGFB2) (NM_003238) Human Mass Spec Standard
CAT#: PH312624
TGFB2 MS Standard C13 and N15-labeled recombinant protein (NP_003229)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212624 |
Predicted MW | 47.6 kDa |
Protein Sequence |
>RC212624 representing NM_003238
Red=Cloning site Green=Tags(s) MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEPEEVPPEVISI YNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFDVSAMEKN ASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEW LHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPH LLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGAC PYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003229 |
RefSeq Size | 1695 |
RefSeq ORF | 1242 |
Synonyms | G-TSF; LDS4; TGF-beta2 |
Locus ID | 7042 |
UniProt ID | P61812, Q59EG9 |
Cytogenetics | 1q41 |
Summary | 'This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Cytokine-cytokine receptor interaction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, Renal cell carcinoma, TGF-beta signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401115 | TGFB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427631 | TGFB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401115 | Transient overexpression lysate of transforming growth factor, beta 2 (TGFB2), transcript variant 2 |
USD 396.00 |
|
LY427631 | Transient overexpression lysate of transforming growth factor, beta 2 (TGFB2), transcript variant 1 |
USD 396.00 |
|
TP312624 | Recombinant protein of human transforming growth factor, beta 2 (TGFB2), transcript variant 2 |
USD 823.00 |
|
TP723440 | Purified recombinant protein of Human transforming growth factor, beta 2 (TGFB2), transcript variant 2. |
USD 140.00 |
|
TP723441 | Purified recombinant protein of Human transforming growth factor, beta 2 (TGFB2), transcript variant 2. |
USD 240.00 |
|
TP723805 | Purified recombinant protein of Human transforming growth factor, beta 2 (TGFB2), transcript variant 1 |
USD 260.00 |
{0} Product Review(s)
Be the first one to submit a review