NPHS2 (NM_014625) Human Mass Spec Standard

CAT#: PH312676

NPHS2 MS Standard C13 and N15-labeled recombinant protein (NP_055440)

Product Images

Coomassie blue staining of purified NPHS2 protein (Cat# TP312676). The protein was produced from HEK293T cells transfected with NPHS2 cDNA clone (Cat# RC212676) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212676
• Predicted MW: 42 kDa
• Protein Sequence:
  Sequence Link

  >RC212676 representing NM_014625
  Red=Cloning site Green=Tags(s)
  
  MERRARSSSRESRGRGGRTPHKENKRAKAERSGGGRGRQEAGPEPSGSGRAGTPGEPRAPAATVVDVDEV
  RGSGEEGTEVVALLESERPEEGTKSSGLGACEWLLVLISLLFIIMTFPFSIWFCVKVVQEYERVIIFRLG
  HLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEIVTKDMFIMEIDAICYYRMENASLLLSSLAHV
  SKAVQFLVQTTMKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAV
  EAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCL
  SSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055440
• RefSeq Size: 1853
• RefSeq ORF: 1149
• Synonyms: PDCN; SRN1
• Locus ID: 7827
• UniProt ID: Q9NP85
• Cytogenetics: 1q25.2
• Summary: This gene encodes a protein that plays a role in the regulation of glomerular permeability. Mutations in this gene cause steroid-resistant nephrotic syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Protein Families: Transmembrane