RASGRP2 (NM_001098671) Human Mass Spec Standard
CAT#: PH312719
RASGRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092141)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212719 |
Predicted MW | 69.2 kDa |
Protein Sequence |
>RC212719 protein sequence
Red=Cloning site Green=Tags(s) MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNS LQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKWKRQVTQRNPVG QKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLM ILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPETIKLWEGLTELV TATGNYGNYRRRLAACVGFRFPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSL RPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSAAKPKLDQ ALVVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSV LGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCKDRLSVECRRRAQSVSLEGS APSPSPMHSHHHRAFSFSLPRPGRRGSRPPEIREEEVQTVEDGVFDIHL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001092141 |
RefSeq Size | 2284 |
RefSeq ORF | 1827 |
Synonyms | CALDAG-GEFI; CDC25L |
Locus ID | 10235 |
UniProt ID | Q7LDG7 |
Cytogenetics | 11q13.1 |
Summary | The protein encoded by this gene is a brain-enriched nucleotide exchanged factor that contains an N-terminal GEF domain, 2 tandem repeats of EF-hand calcium-binding motifs, and a C-terminal diacylglycerol/phorbol ester-binding domain. This protein can activate small GTPases, including RAS and RAP1/RAS3. The nucleotide exchange activity of this protein can be stimulated by calcium and diacylglycerol. Four alternatively spliced transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
Protein Pathways | Chemokine signaling pathway, MAPK signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406966 | RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420662 | RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420663 | RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC426039 | RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426040 | RASGRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406966 | Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 2 |
USD 605.00 |
|
LY420662 | Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 3 |
USD 605.00 |
|
LY420663 | Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 4 |
USD 605.00 |
|
LY426039 | Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 3 |
USD 396.00 |
|
LY426040 | Transient overexpression lysate of RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 4 |
USD 396.00 |
|
PH312672 | RASGRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092140) |
USD 2,055.00 |
|
PH317525 | RASGRP2 MS Standard C13 and N15-labeled recombinant protein (NP_722541) |
USD 2,055.00 |
|
TP312672 | Recombinant protein of human RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 3 |
USD 788.00 |
|
TP312719 | Recombinant protein of human RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 4 |
USD 823.00 |
|
TP317525 | Recombinant protein of human RAS guanyl releasing protein 2 (calcium and DAG-regulated) (RASGRP2), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review