DPM3 (NM_018973) Human Mass Spec Standard
CAT#: PH312952
DPM3 MS Standard C13 and N15-labeled recombinant protein (NP_061846)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212952 |
Predicted MW | 13.3 kDa |
Protein Sequence |
>RC212952 protein sequence
Red=Cloning site Green=Tags(s) MLSVGGLRLSLVRFSFLLLRGALLPSLAVTMTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWP LPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061846 |
RefSeq Size | 532 |
RefSeq ORF | 366 |
Synonyms | CDG1O |
Locus ID | 54344 |
UniProt ID | Q9P2X0, A0A140VJI4 |
Cytogenetics | 1q22 |
Summary | Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. The protein encoded by this gene is a subunit of dolichyl-phosphate mannosyltransferase and acts as a stabilizer subunit of the dolichyl-phosphate mannosyltransferase complex. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, N-Glycan biosynthesis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412819 | DPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY412819 | Transient overexpression lysate of dolichyl-phosphate mannosyltransferase polypeptide 3 (DPM3), transcript variant 1 |
USD 325.00 |
|
TP312952 | Recombinant protein of human dolichyl-phosphate mannosyltransferase polypeptide 3 (DPM3), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review