DHLAG (CD74) (NM_001025159) Human Mass Spec Standard

CAT#: PH312964

CD74 MS Standard C13 and N15-labeled recombinant protein (NP_001020330)

Product Images

Coomassie blue staining of purified CD74 protein (Cat# TP312964). The protein was produced from HEK293T cells transfected with CD74 cDNA clone (Cat# RC212964) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212964
• Predicted MW: 33.3 kDa
• Protein Sequence:
  Sequence Link

  >RC212964 representing NM_001025159
  Red=Cloning site Green=Tags(s)
  
  MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYF
  LYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTED
  HVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVL
  TKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDP
  SSGLGVTKQDLGPVPM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001020330
• RefSeq Size: 1519
• RefSeq ORF: 888
• Synonyms: DHLAG; HLADG; Ia-GAMMA; II; p33
• Locus ID: 972
• UniProt ID: P04233
• Cytogenetics: 5q33.1
• Summary: 'The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Antigen processing and presentation