TAF1 48 (TAF1A) (NM_005681) Human Mass Spec Standard
CAT#: PH312971
TAF1A MS Standard C13 and N15-labeled recombinant protein (NP_005672)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC212971 |
Predicted MW | 52.5 kDa |
Protein Sequence |
>RC212971 representing NM_005681
Red=Cloning site Green=Tags(s) MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQW QQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEILFYHPKSNMESFNTFANRMKNIGVMNYLKISLQH ALYLLHHGMLKDAKRNLSEAETWRHGENTSSREILINLIQAYKGLLQYYTWSEKKMELSKLDKDDYAYNA VAQDVFNHSWKTSANISALIKIPGVWDPFVKSYVEMLEFYGDRDGAQEVLTNYAYDEKFPSNPNAHIYLY NFLKRQKAPRSKLISVLKILYQIVPSHKLMLEFHTLLRKSEKEEHRKLGLEVLFGVLDFAGCTKNITAWK YLAKYLKNILMGNHLAWVQEEWNSRKNWWPGFHFSYFWAKSDWKEDTALACEKAFVAGLLLGKGCRYFRY ILKQDHQILGKKIKRMKRSVKKYSIVNPRL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005672 |
RefSeq Size | 1893 |
RefSeq ORF | 1350 |
Synonyms | MGC:17061; RAFI48; SL1; TAFI48 |
Locus ID | 9015 |
UniProt ID | Q15573, B4DS21 |
Cytogenetics | 1q41 |
Summary | This gene encodes a subunit of the RNA polymerase I complex, Selectivity Factor I (SLI). The encoded protein is a TATA box-binding protein-associated factor that plays a role in the assembly of the RNA polymerase I preinitiation complex. Alternate splicing results in multiple transcript variants encoding multiple isoforms. [provided by RefSeq, Jan 2011] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401732 | TAF1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC408297 | TAF1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401732 | Transient overexpression lysate of TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 1 |
USD 396.00 |
|
LY408297 | Transient overexpression lysate of TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 2 |
USD 396.00 |
|
TP312971 | Recombinant protein of human TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 1 |
USD 823.00 |
|
TP760550 | Purified recombinant protein of Human TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa (TAF1A), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review