ALDH8A1 (NM_022568) Human Mass Spec Standard
CAT#: PH313029
ALDH8A1 MS Standard C13 and N15-labeled recombinant protein (NP_072090)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213029 |
Predicted MW | 53.4 kDa |
Protein Sequence |
>RC213029 protein sequence
Red=Cloning site Green=Tags(s) MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPSWSSRSPQERS RVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASSSLHHTSECTQMDHLGCMHYT VRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPSELTSVTAWMLCKLLDKAGVPPGVVNIVFGT GPRVGEALVSHPEVPLISFTGSQPTAERITQLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSF ANQGEICLCTSRIFVQKSIYSEFLKRFVEATRKWKVGIPSDPLVSIGALISKAHLEKVRSYVKRALAEGA QIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLA ATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEIKTITVKH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_072090 |
RefSeq Size | 2567 |
RefSeq ORF | 1461 |
Synonyms | ALDH12; DJ352A20.2 |
Locus ID | 64577 |
UniProt ID | Q9H2A2 |
Cytogenetics | 6q23.3 |
Summary | This gene encodes a member of the aldehyde dehydrogenase family of proteins. The encoded protein has been implicated in the synthesis of 9-cis-retinoic acid and in the breakdown of the amino acid tryptophan. This enzyme converts 9-cis-retinal into the retinoid X receptor ligand 9-cis-retinoic acid, and has approximately 40-fold higher activity with 9-cis-retinal than with all-trans-retinal. In addition, this enzyme has been shown to catalyze the conversion of 2-aminomuconic semialdehyde to 2-aminomuconate in the kynurenine pathway of tryptophan catabolism. [provided by RefSeq, Jul 2018] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406874 | ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC411634 | ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC430323 | ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC434230 | ALDH8A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406874 | Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 2 |
USD 605.00 |
|
LY411634 | Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 1 |
USD 605.00 |
|
LY430323 | Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 2 |
USD 396.00 |
|
LY434230 | Transient overexpression lysate of aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 3 |
USD 396.00 |
|
TP313029 | Recombinant protein of human aldehyde dehydrogenase 8 family, member A1 (ALDH8A1), transcript variant 1 |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review