KLF14 (NM_138693) Human Mass Spec Standard

CAT#: PH313087

KLF14 MS Standard C13 and N15-labeled recombinant protein (NP_619638)

Product Images

Coomassie blue staining of purified KLF14 protein (Cat# TP313087). The protein was produced from HEK293T cells transfected with KLF14 cDNA clone (Cat# RC213087) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213087
• Predicted MW: 32.9 kDa
• Protein Sequence:
  Sequence Link

  >RC213087 representing NM_138693
  Red=Cloning site Green=Tags(s)
  
  MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAHPESALPGPGPSGPASVPQLPQVP
  APSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPCSVQTPCSELAPASGAAAVCA
  PESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAADQAPRRRSVTPAAKRHQCPFPGCTKAYYKSS
  HLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTY
  HPDMIEYRGRRRTPRIDPPLTSEVESSASGSGPGPAPSFTTCL
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_619638
• RefSeq Size: 1383
• RefSeq ORF: 969
• Synonyms: BTEB5
• Locus ID: 136259
• UniProt ID: Q8TD94
• Cytogenetics: 7q32.2
• Summary: This intronless gene encodes a member of the Kruppel-like family of transcription factors. The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene expression. This gene exhibits imprinted expression from the maternal allele in embryonic and extra-embryonic tissues. [provided by RefSeq, Jul 2013]