C8orf42 (TDRP) (NM_175075) Human Mass Spec Standard

CAT#: PH313199

C8orf42 MS Standard C13 and N15-labeled recombinant protein (NP_778250)

Product Images

Coomassie blue staining of purified TDRP protein (Cat# TP313199). The protein was produced from HEK293T cells transfected with TDRP cDNA clone (Cat# RC213199) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213199
• Predicted MW: 20.2 kDa
• Protein Sequence:
  Sequence Link

  >RC213199 representing NM_175075
  Red=Cloning site Green=Tags(s)
  
  MVWGRAGSWGRVWGGFGGEGAGLVLGVPRPRLSPARPTGPASRRSRRQSVRRPGGTRSHSPTHGRRDAGA
  RLTMWKLGRGRVLLDEPPEEEDGLRGGPPPAAAAAAQAQVQGASFRGWKEVTSLFNKDDEQHLLERCKSP
  KSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWE
  DDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEAE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_778250
• RefSeq Size: 1901
• RefSeq ORF: 774
• Synonyms: C8orf42; Inm01; TDRP1; TDRP2
• Locus ID: 157695
• UniProt ID: Q86YL5
• Cytogenetics: 8p23.3