MEMO1 (NM_015955) Human Mass Spec Standard

CAT#: PH313245

MEMO1 MS Standard C13 and N15-labeled recombinant protein (NP_057039)

Product Images

Coomassie blue staining of purified MEMO1 protein (Cat# TP313245). The protein was produced from HEK293T cells transfected with MEMO1 cDNA clone (Cat# RC213245) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213245
• Predicted MW: 33.7 kDa
• Protein Sequence:
  Sequence Link

  >RC213245 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSI
  TRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYT
  AKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIY
  RSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCR
  NWQDSSVSYAAGALTVH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057039
• RefSeq Size: 1878
• RefSeq ORF: 891
• Synonyms: C2orf4; CGI-27; MEMO; NS5ATP7
• Locus ID: 51072
• UniProt ID: Q9Y316
• Cytogenetics: 2p22.3