EDDM3B (NM_022360) Human Mass Spec Standard

CAT#: PH313305

EDDM3B MS Standard C13 and N15-labeled recombinant protein (NP_071755)

Product Images

Coomassie blue staining of purified EDDM3B protein (Cat# TP313305). The protein was produced from HEK293T cells transfected with EDDM3B cDNA clone (Cat# RC213305) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213305
• Predicted MW: 17.6 kDa
• Protein Sequence:
  Sequence Link

  >RC213305 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSVKIWGTLLALLCILCTLLVQSKEVSWREFMKQHYLSPSREFREYKCDVLMRENEALKDKSSHMFIY
  ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDGYVDSIEDLK
  MVEPIGN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071755
• RefSeq Size: 897
• RefSeq ORF: 441
• Synonyms: EP3B; FAM12B; HE3-BETA; HE3B; RAM2
• Locus ID: 64184
• UniProt ID: P56851, W0UV31
• Cytogenetics: 14q11.2
• Summary: Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein, Transmembrane