CPEB1 (NM_001079534) Human Mass Spec Standard
CAT#: PH313337
CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073002)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213337 |
Predicted MW | 53.6 kDa |
Protein Sequence |
>RC213337 protein sequence
Red=Cloning site Green=Tags(s) MLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSAQSSTHSVLSMLHNPLGNVLGKPPLS FLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLS LSGGGPRDPLKMGVGSRMDQEQAALAAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQA AAVNEATCTWSGQLPPRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKG YVYLVFELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSR TVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTTKF TKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001073002 |
RefSeq Size | 3095 |
RefSeq ORF | 1458 |
Synonyms | CPE-BP1; CPEB; CPEB-1; h-CPEB; hCPEB-1 |
Locus ID | 64506 |
UniProt ID | Q9BZB8 |
Cytogenetics | 15q25.2 |
Summary | This gene encodes a member of the cytoplasmic polyadenylation element binding protein family. This highly conserved protein binds to a specific RNA sequence, called the cytoplasmic polyadenylation element, found in the 3' untranslated region of some mRNAs. The encoded protein functions in both the cytoplasm and the nucleus. It is involved in the regulation of mRNA translation, as well as processing of the 3' untranslated region, and may play a role in cell proliferation and tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
Protein Pathways | Dorso-ventral axis formation, Oocyte meiosis, Progesterone-mediated oocyte maturation |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410792 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC421521 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC421522 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC421523 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425886 | CPEB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY410792 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1 |
USD 325.00 |
|
LY421521 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 2 |
USD 495.00 |
|
LY421522 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 4 |
USD 495.00 |
|
LY421523 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3 |
USD 325.00 |
|
LY425886 | Transient overexpression lysate of cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3 |
USD 325.00 |
|
PH306406 | CPEB1 MS Standard C13 and N15-labeled recombinant protein (NP_001073003) |
USD 2,055.00 |
|
TP306406 | Recombinant protein of human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 3 |
USD 867.00 |
|
TP313337 | Recombinant protein of human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 4 |
USD 748.00 |
|
TP761390 | Purified recombinant protein of Human cytoplasmic polyadenylation element binding protein 1 (CPEB1), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review