CTSA (NM_000308) Human Mass Spec Standard

CAT#: PH313409

CTSA MS Standard C13 and N15-labeled recombinant protein (NP_000299)

Product Images

Coomassie blue staining of purified CTSA protein (Cat# TP313409). The protein was produced from HEK293T cells transfected with CTSA cDNA clone (Cat# RC213409) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213409
• Predicted MW: 56.12 kDa
• Protein Sequence:
  Sequence Link

  >RC213409 representing NM_000308
  Red=Cloning site Green=Tags(s)
  
  MTSSPRAPPGEQGRGGAEMIRAAPPPLFLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGY
  LKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANV
  LYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQ
  DPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEV
  ARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTN
  TTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMAC
  NFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSR
  FLNKQPY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000299
• RefSeq Size: 2254
• RefSeq ORF: 2012
• Synonyms: GLB2; GSL; NGBE; PPCA; PPGB
• Locus ID: 5476
• UniProt ID: P10619, X6R8A1
• Cytogenetics: 20q13.12
• Summary: 'This gene encodes a member of the peptidase S10 family of serine carboxypeptidases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate two chains that comprise the heterodimeric active enzyme. This enzyme possesses deamidase, esterase and carboxypeptidase activities and acts as a scaffold in the lysosomal multienzyme complex. Mutations in this gene are associated with galactosialidosis. [provided by RefSeq, Nov 2015]'
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Renin-angiotensin system