Gemin 8 (GEMIN8) (NM_017856) Human Mass Spec Standard

CAT#: PH313444

GEMIN8 MS Standard C13 and N15-labeled recombinant protein (NP_060326)

Product Images

Coomassie blue staining of purified GEMIN8 protein (Cat# TP313444). The protein was produced from HEK293T cells transfected with GEMIN8 cDNA clone (Cat# RC213444) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213444
• Predicted MW: 28.6 kDa
• Protein Sequence:
  Sequence Link

  >RC213444 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVKASTSKATRPWYSHPVYARYWQHYHQAMAWMQSHHNAYRKAVESCFNLPWYLPSALLPQSSYDNEA
  AYPQSFYDHHVAWQDYPCSSSHFRRSGQHPRYSSRIQASTKEDQALSKEEEMETESDAEVECDLSNMEIT
  EELRQYFAETERHREERRRQQQLDAERLDSYVNADHDLYCNTRRSVEAPTERPGERRQAEMKRLYGDSAA
  KIQAMEAAVQLSFDKHCDRKQPKYWPVIPLKF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060326
• RefSeq Size: 3259
• RefSeq ORF: 726
• Synonyms: FAM51A1
• Locus ID: 54960
• UniProt ID: Q9NWZ8, A0A024RBX2
• Cytogenetics: Xp22.2
• Summary: The protein encoded by this gene is part of the SMN complex, which is necessary for spliceosomal snRNP assembly in the cytoplasm and pre-mRNA splicing in the nucleus. The encoded protein binds to both SMN1 and the GEMIN6/GEMIN7 heterodimer, mediating their interaction. This protein is found in nuclear Gemini of Cajal bodies (gems) and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, May 2010]