GJA8 (NM_005267) Human Mass Spec Standard

CAT#: PH313469

GJA8 MS Standard C13 and N15-labeled recombinant protein (NP_005258)

Product Images

Coomassie blue staining of purified GJA8 protein (Cat# TP313469). The protein was produced from HEK293T cells transfected with GJA8 cDNA clone (Cat# RC213469) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213469
• Predicted MW: 48 kDa
• Protein Sequence:
  Sequence Link

  >RC213469 representing NM_005267
  Red=Cloning site Green=Tags(s)
  
  MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGCENVCYDEAF
  PISHIRLWVLQIIFVSTPSLMYVGHAVHYVRMEEKRKSREAEELGQQAGTNGGPDQGSVKKSSGSKGTKK
  FRLEGTLLRTYICHIIFKTLFEVGFIVGHYFLYGFRILPLYRCSRWPCPNVVDCFVSRPTEKTIFILFML
  SVASVSLFLNVMELGHLGLKGIRSALKRPVEQPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFP
  LTEVGMVETSPLPAKPFNQFEEKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKK
  EEAERLTTEEQEKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLS
  KASSRARSDDLTV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005258
• RefSeq Size: 1374
• RefSeq ORF: 1299
• Synonyms: CAE; CAE1; CTRCT1; CX50; CZP1; MP70
• Locus ID: 2703
• UniProt ID: P48165, X5D7G1
• Cytogenetics: 1q21.2
• Summary: 'This gene encodes a transmembrane connexin protein that is necessary for lens growth and maturation of lens fiber cells. The encoded protein is a component of gap junction channels and functions in a calcium and pH-dependent manner. Mutations in this gene have been associated with zonular pulverulent cataracts, nuclear progressive cataracts, and cataract-microcornea syndrome. [provided by RefSeq, Dec 2009]'
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane