SH3GL3 (NM_003027) Human Mass Spec Standard

CAT#: PH313522

SH3GL3 MS Standard C13 and N15-labeled recombinant protein (NP_003018)

Product Images

Coomassie blue staining of purified SH3GL3 protein (Cat# TP313522). The protein was produced from HEK293T cells transfected with SH3GL3 cDNA clone (Cat# RC213522) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213522
• Predicted MW: 39.1 kDa
• Protein Sequence:
  Sequence Link

  >RC213522 representing NM_003027
  Red=Cloning site Green=Tags(s)
  
  MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGM
  LNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFI
  DPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVE
  QVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTG
  SNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003018
• RefSeq Size: 2015
• RefSeq ORF: 1041
• Synonyms: CNSA3; EEN-B2; HsT19371; SH3D2C; SH3P13
• Locus ID: 6457
• UniProt ID: Q99963
• Cytogenetics: 15q25.2
• Summary: ''
• Protein Pathways: Endocytosis